PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sopim06g009640.0.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family bZIP
Protein Properties Length: 145aa    MW: 16624.6 Da    PI: 5.3061
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sopim06g009640.0.1genomeCSHLView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_138.13.3e-122482563
                        CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1  5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63
                        ++ +r+++NRe+A+rsR +K++++eeL  +  +L+++N+  ++++ + + ++ + ++e+
  Sopim06g009640.0.1 24 RKRKRMESNRESAKRSRMKKQQRLEELSSETTQLQNQNSICRDKIASVEMNYRSIDAEN 82
                        5789*****************************************99999999888776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.20.5.1703.7E-122074No hitNo description
SMARTSM003389.5E-152084IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.8752285IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.63E-102472No hitNo description
PfamPF001702.7E-92472IPR004827Basic-leucine zipper domain
CDDcd147025.12E-182576No hitNo description
PROSITE patternPS0003602742IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 145 aa     Download sequence    Send to blast
MSSTPHLVSS GSDADQRYAK FDERKRKRME SNRESAKRSR MKKQQRLEEL SSETTQLQNQ  60
NSICRDKIAS VEMNYRSIDA ENNVLRAQLA ELTERLNSLN SLTQFWADTT GFPVDIPEIP  120
DTLLEPWQLP CPIQPITASD MFQF*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9755180.0HG975518.1 Solanum lycopersicum chromosome ch06, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004240572.11e-104PREDICTED: ocs element-binding factor 1-like
SwissprotQ9LZP82e-43BZP53_ARATH; bZIP transcription factor 53
TrEMBLK4C3Z41e-104K4C3Z4_SOLLC; Uncharacterized protein
STRINGSolyc06g009640.1.11e-103(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA28102351
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G62420.19e-45basic region/leucine zipper motif 53